Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TULP2 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP310473100UL
Description
TULP2 Polyclonal specifically detects TULP2 in Human samples. It is validated for Western Blot, Immunohistochemistry.Specifications
TULP2 | |
Polyclonal | |
Western Blot 1.0 ug/ml, Immunohistochemistry | |
Cancer/testis antigen 65, CT65cancer testis antigen 65, tubby like protein 2, Tubby-like protein 2, TUBL2tubby-related protein 2 | |
The immunogen is a synthetic peptide directed towards the N terminal region of human TULP2 (NP_003314). Peptide sequence MSQDNDTLMRDILGHELAAMRLQKLEQQRRLFEKKQRQKRQELLMVQANP | |
100 μg | |
Vision | |
7288 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Western Blot, Immunohistochemistry | |
Unconjugated | |
PBS buffer, 2% sucrose | |
Rabbit | |
Affinity purified | |
RUO | |
Primary | |
Human | |
Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction