Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Twist-1 Antibody, Novus Biologicals™
SDP

Catalog No. NB12049254 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB12049254 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NB12049254 Supplier Novus Biologicals Supplier No. NB12049254
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

Twist-1 Polyclonal specifically detects Twist-1 in Human, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen Twist-1
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Concentration 1 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Alias acrocephalosyndactyly 3, ACS3, B-HLH DNA binding protein, BHLHA38, bHLHa38BPES3, Class A basic helix-loop-helix protein 38, CRS1, H-twistblepharophimosis, epicanthus inversus and ptosis 3, SCSBPES2, TWIST, twist homolog 1 (Drosophila), TWIST homolog of drosophila, twist-related protein 1
Gene Symbols TWIST1
Host Species Rabbit
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human Twist-1. Peptide Sequence DKLSKIQTLKLAARYIDFLYQVLQSDELDSKMASCSYVAHERLSYAFSVW. The peptide sequence for this immunogen was taken from within the described region.
Molecular Weight of Antigen 21 kDa
Purification Method Protein A purified
Quantity 100 μL
Regulatory Status RUO
Research Discipline Cancer
Primary or Secondary Primary
Gene ID (Entrez) 7291
Test Specificity TWIST1
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Human, Rat, Pig, Bovine, Canine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.