Twist-2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP256209

Catalog No. NBP256209

Description

Twist-2 Polyclonal specifically detects Twist-2 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: Twist-2
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
• Gene Alias: BHLHA39, bHLHa39twist-related bHLH protein Dermo1, Class A basic helix-loop-helix protein 39, Dermis-expressed protein 1, Dermo-1, DERMO1MGC117334, twist homolog 2 (Drosophila), twist-related protein 2
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: TWIST2
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:ELERQPKRFGRKRRYSKKSSEDGSPTPGKRGKKGSPSAQSFEELQSQRIL
• Quantity: 100 μL
• Research Discipline: Inhibitors Activators and Regulators
• Gene ID (Entrez): 117581
• Target Species: Human
• Isotype: IgG

For Research Use Only