Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

TYMS opposite strand Antibody, Novus Biologicals™
SDP

Catalog No. NBP157050 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP157050 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP157050 Supplier Novus Biologicals Supplier No. NBP157050

Item Discontinued This item has been discontinued by the supplier. Please to view product availability in your area.

Rabbit Polyclonal Antibody

TYMS opposite strand Polyclonal specifically detects TYMS opposite strand in Human samples. It is validated for Western Blot.

Specifications

Antigen C18orf56
Applications Western Blot
Classification Polyclonal
Concentration 0.5 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q8TAI1
Gene Alias chromosome 18 open reading frame 56, putative uncharacterized protein C18orf56
Gene Symbols C18ORF56
Host Species Rabbit
Immunogen Synthetic peptides corresponding to C18orf56 (chromosome 18 open reading frame 56) The peptide sequence was selected from the N terminal of C18orf56. Peptide sequence MTPASGATASLGRLRARPRSRWDAAYLPAVAAVCVARASHVPNGTLRFGV.
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 494514
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.