Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

UAF1/WDR48 Antibody, Novus Biologicals™
SDP

Catalog No. NBP181404 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
0.1 mL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP181404 0.1 mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP181404 Supplier Novus Biologicals Supplier No. NBP181404
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

UAF1/WDR48 Polyclonal specifically detects UAF1/WDR48 in Human samples. It is validated for Western Blot, Simple Western, Chromatin Immunoprecipitation, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunoprecipitation, Immunohistochemistry-Paraffin.

Specifications

Antigen UAF1/WDR48
Applications Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunoprecipitation
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.04-0.4 ug/ml, Simple Western 1:20, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunoprecipitation, Immunohistochemistry-Paraffin 1:50 - 1:200, Chromatin Immunoprecipitation (ChIP)
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Accession No. Q8TAF3
Gene Alias KIAA1449DKFZp686G1794, P80, UAF1, USP1 associated factor 1, USP1-associated factor 1, WD repeat domain 48, WD repeat endosomal protein, WD repeat-containing protein 48
Gene Symbols WDR48
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:SIIQCHILNDKRHILTKDTNNNVAYWDVLKACKVEDLGKVDFEDEIKKRFKMVYVPNWFSVDLKTGMLTITLDESDCFAAWVSAKDAGF
Molecular Weight of Antigen 76 kDa
Purification Method Affinity Purified
Quantity 0.1 mL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 57599
Test Specificity Specificity of human UAF1/WDR48 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human, Mouse, Rat
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.