Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. UAP1L1 Antibody, Novus Biologicals™

UAP1L1 Antibody, Novus Biologicals™
SDP

Catalog No. NBP174151 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP174151 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP174151 Supplier Novus Biologicals Supplier No. NBP174151
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

UAP1L1 Polyclonal specifically detects UAP1L1 in Mouse samples. It is validated for Western Blot.

Specifications

Antigen UAP1L1
Applications Western Blot
Classification Polyclonal
Concentration 0.5 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q3TW96
Gene Alias EC 2.7.7, EC 2.7.7.-, EC 2.7.7.23, EC 2.7.7.27, RP11-229P13.18, UDP-N-acetylhexosamine pyrophosphorylase-like protein 1, UDP-N-acteylglucosamine pyrophosphorylase 1-like 1
Gene Symbols UAP1L1
Host Species Rabbit
Immunogen Synthetic peptides corresponding to the middle region of UAP1L1 Immunizing peptide sequence KVPYVDEEGNLVKPLRPNGIKMEKFVFDVFQFAKNFVAFEVCREEEFSPL.
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 91373
Test Specificity Expected identity based on immunogen sequence: Human: 100%; Mouse: 100%; Rat: 100%; Chicken: 92%; Guinea pig: 92%; Equine: 92%; Zebrafish: 83%.
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Human, Mouse, Rat, Canine, Equine, Guinea Pig, Zebrafish
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.