Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

UBE2N/Ubc13 Antibody, Novus Biologicals™
SDP

Catalog No. NBP155027 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP155027 100 μL
NBP15502720 20 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP155027 Supplier Novus Biologicals Supplier No. NBP155027
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

UBE2N/Ubc13 Polyclonal specifically detects UBE2N/Ubc13 in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry.

Specifications

Antigen UBE2N/Ubc13
Applications Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence
Classification Polyclonal
Concentration 1 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml, Immunohistochemistry
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. P61088
Gene Alias bendless-like ubiquitin conjugating enzyme, Bendless-like ubiquitin-conjugating enzyme, BLU, EC 6.3.2.19, MGC131857, MGC8489, UBC13, UbcH-ben, Ubiquitin carrier protein N, ubiquitin-conjugating enzyme E2 N, ubiquitin-conjugating enzyme E2N (homologous to yeast UBC13), ubiquitin-conjugating enzyme E2N (UBC13 homolog, yeast), Ubiquitin-protein ligase N, yeast UBC13 homolog
Gene Symbols UBE2N
Host Species Rabbit
Immunogen Synthetic peptides corresponding to UBE2N (ubiquitin-conjugating enzyme E2N (UBC13 homolog, yeast)) The peptide sequence was selected from the middle region of UBE2N. Peptide sequence VDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLANDVAEQW.
Molecular Weight of Antigen 17 kDa
Purification Method Protein A purified
Quantity 100 μL
Regulatory Status RUO
Research Discipline Cancer
Primary or Secondary Primary
Gene ID (Entrez) 7334
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Sheep, Yeast, Zebrafish
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.