Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

UBE2N/Ubc13 Antibody, Novus Biologicals™
SDP

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP155027

 View more versions of this product

Catalog No. NBP155027


Only null left
Add to Cart

Description

Description

UBE2N/Ubc13 Polyclonal specifically detects UBE2N/Ubc13 in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry.
Specifications

Specifications

UBE2N/Ubc13
Polyclonal
Unconjugated
PBS, 2% Sucrose with 0.09% Sodium Azide
bendless-like ubiquitin conjugating enzyme, Bendless-like ubiquitin-conjugating enzyme, BLU, EC 6.3.2.19, MGC131857, MGC8489, UBC13, UbcH-ben, Ubiquitin carrier protein N, ubiquitin-conjugating enzyme E2 N, ubiquitin-conjugating enzyme E2N (homologous to yeast UBC13), ubiquitin-conjugating enzyme E2N (UBC13 homolog, yeast), Ubiquitin-protein ligase N, yeast UBC13 homolog
Rabbit
17 kDa
100 μL
Cancer
7334
Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Sheep, Yeast, Zebrafish
Purified
Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence
1 mg/ml
Western Blot 1.0 ug/ml, Immunohistochemistry
P61088
UBE2N
Synthetic peptides corresponding to UBE2N (ubiquitin-conjugating enzyme E2N (UBC13 homolog, yeast)) The peptide sequence was selected from the middle region of UBE2N. Peptide sequence VDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLANDVAEQW.
Protein A purified
RUO
Primary
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
IgG
Product Suggestions

Product Suggestions

Videos
SDS
Documents

Documents

Product Certifications
Promotions

Promotions

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Your feedback has been submitted: Thank you for helping us improve our website.