UBE2N/Ubc13 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP15502720UL

Catalog No. NBP15502720

Description

UBE2N/Ubc13 Polyclonal specifically detects UBE2N/Ubc13 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: UBE2N/Ubc13
• Classification: Polyclonal
• Dilution: Western Blot 1:100-1:2000, Immunocytochemistry/Immunofluorescence 1:10-1:2000
• Gene Accession No.: P61088
• Gene Symbols: UBE2N
• Immunogen: Synthetic peptides corresponding to UBE2N (ubiquitin-conjugating enzyme E2N (UBC13 homolog, yeast)) The peptide sequence was selected from the middle region of UBE2N. Peptide sequence VDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLANDVAEQW.
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified

• Applications: Western Blot, Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: bendless-like ubiquitin conjugating enzyme, Bendless-like ubiquitin-conjugating enzyme, BLU, EC 6.3.2.19, MGC131857, MGC8489, UBC13, UbcH-ben, Ubiquitin carrier protein N, ubiquitin-conjugating enzyme E2 N, ubiquitin-conjugating enzyme E2N (homologous to yeast UBC13), ubiquitin-conjugating enzyme E2N (UBC13 homolog, yeast), Ubiquitin-protein ligase N, yeast UBC13 homolog
• Host Species: Rabbit
• Molecular Weight of Antigen: 17 kDa
• Quantity: 20 μL
• Research Discipline: Cancer
• Gene ID (Entrez): 7334
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.
• Isotype: IgG