Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
UBE2N/Ubc13 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$206.00 - $487.50
Specifications
| Antigen | UBE2N/Ubc13 |
|---|---|
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Form | Purified |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP15502720
|
Novus Biologicals
NBP15502720UL |
20 μL |
Each for $206.00
|
|
|||||
|
NBP155027
|
Novus Biologicals
NBP155027 |
100 μL |
Each for $487.50
|
|
|||||
Description
UBE2N/Ubc13 Polyclonal specifically detects UBE2N/Ubc13 in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry.Specifications
| UBE2N/Ubc13 | |
| Unconjugated | |
| Rabbit | |
| Cancer | |
| bendless-like ubiquitin conjugating enzyme, Bendless-like ubiquitin-conjugating enzyme, BLU, EC 6.3.2.19, MGC131857, MGC8489, UBC13, UbcH-ben, Ubiquitin carrier protein N, ubiquitin-conjugating enzyme E2 N, ubiquitin-conjugating enzyme E2N (homologous to yeast UBC13), ubiquitin-conjugating enzyme E2N (UBC13 homolog, yeast), Ubiquitin-protein ligase N, yeast UBC13 homolog | |
| UBE2N | |
| IgG | |
| Protein A purified |
| Polyclonal | |
| Purified | |
| RUO | |
| P61088 | |
| 7334 | |
| Synthetic peptides corresponding to UBE2N (ubiquitin-conjugating enzyme E2N (UBC13 homolog, yeast)) The peptide sequence was selected from the middle region of UBE2N. Peptide sequence VDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLANDVAEQW. | |
| Primary | |
| 17 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title