Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

UBE2N/Ubc13 Antibody, Novus Biologicals™
SDP

Catalog No. NB395976 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB395976 25 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NB395976 Supplier Novus Biologicals Supplier No. NBP24882325UL
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

UBE2N/Ubc13 Polyclonal antibody specifically detects UBE2N/Ubc13 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)

Specifications

Antigen UBE2N/Ubc13
Applications Western Blot, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.04-0.4 μg/mL, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL, Immunohistochemistry-Paraffin 1:50 - 1:200
Formulation PBS (pH 7.2), 40% Glycerol
Gene Alias bendless-like ubiquitin conjugating enzyme, Bendless-like ubiquitin-conjugating enzyme, BLU, EC 6.3.2.19, MGC131857, MGC8489, UBC13, UbcH-ben, Ubiquitin carrier protein N, ubiquitin-conjugating enzyme E2 N, ubiquitin-conjugating enzyme E2N (homologous to yeast UBC13), ubiquitin-conjugating enzyme E2N (UBC13 homolog, yeast), Ubiquitin-protein ligase N, yeast UBC13 homolog
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: IIKETQRLLAEPVPGIKAEPDESNARYFHVVIA
Purification Method Immunogen affinity purified
Quantity 25 μL
Regulatory Status RUO
Research Discipline Cancer
Primary or Secondary Primary
Gene ID (Entrez) 7334
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.