Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

UBR1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier: Novus Biologicals NBP31795725UL

View more versions of this product

Catalog No. NB159945

$343.50 / Each of 1

Already have an account? Sign In to view your price. New here? Register with us today!

Qty

Add to Cart

This item is not returnable. View return policy

Description

UBR1 Polyclonal antibody specifically detects UBR1 in Human samples. It is validated for Immunofluorescence

Specifications

Antigen	UBR1
Classification	Polyclonal
Dilution	Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Gene Alias	E3 ubiquitin-protein ligase UBR1, E3a ligase, EC 6.3.2.-, JBS, MGC142065, MGC142067, N-recognin-1, ubiquitin ligase E3 alpha-I, ubiquitin protein ligase E3 component n-recognin 1, ubiquitin-protein ligase E3-alpha, Ubiquitin-protein ligase E3-alpha-1, Ubiquitin-protein ligase E3-alpha-I
Immunogen	This antibody was developed against Recombinant Protein corresponding to amino acids: EYLCPLCKSLCNTVIPIIPLQPQKINSENADALAQLLTLARWIQTVLARISGYNIRHAKGENPIPIFFNQGMGDSTLEFHSILSFGVESSIKYSNSIKEMVILFATTIYRIGLKVPPD
Quantity	25 μg
Primary or Secondary	Primary
Target Species	Human
Form	Purified

Applications	Immunofluorescence
Conjugate	Unconjugated
Formulation	PBS, pH 7.2, 40% glycerol
Host Species	Rabbit
Purification Method	Affinity purified
Regulatory Status	RUO
Gene ID (Entrez)	197131
Content And Storage	Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype	IgG

Product Suggestions

Customers who viewed this item also viewed This information does not imply a recommendation or representation of any kind and any action taken upon the information provided is strictly at your own risk. The products shown have not been qualified by Fisher Scientific for any particular purpose, application or use and it is the responsibility of the purchaser to ensure that the performance of the product is suitable for the purchasers specific use or intended application.

Viewing 1-5 of 8

Catalog No. BDB564220

Fc Block , Unlabeled, Clone: 3070, BD Fc Block , Unlabeled, Clone: 3070, BD

$198.00 / Each
Catalog No. PI23209

Thermo Scientific ™ Pierce ™ Bovine Serum Alb Thermo Scientific ™ Pierce ™ Bovine Serum Alb

$107.65 / Pack of 10

Save 34% Reg: $161.90
Catalog No. BP1600-100

Fisher BioReagents ™ Bovine Serum Albumin, Hea Fisher BioReagents ™ Bovine Serum Albumin, Hea

$480.00 - $2320.00
Catalog No. PI23227

Thermo Scientific ™ Pierce ™ BCA Protein Assa Thermo Scientific ™ Pierce ™ BCA Protein Assa

$186.65 / Each

Save 31% Reg: $272.00
Catalog No. PI89900

Thermo Scientific ™ RIPA Lysis and Extraction Thermo Scientific ™ RIPA Lysis and Extraction

$225.50 / Each
Catalog No. PI78440

Thermo Scientific ™ Halt ™ Protease and Phosp Thermo Scientific ™ Halt ™ Protease and Phosp

$411.50 / Each
Catalog No. PI87786

Thermo Scientific ™ Halt ™ Protease Inhibitor Thermo Scientific ™ Halt ™ Protease Inhibitor

$221.00 / Each
Catalog No. PI34028

Thermo Scientific ™ 1-Step ™ TMB ELISA Substr Thermo Scientific ™ 1-Step ™ TMB ELISA Substr

$224.65 / Each

Save 29% Reg: $318.00

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

UBR1 Rabbit anti-Human, Polyclonal, Novus Biologicals™ > 25 μg; Unconjugated

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

Spot an opportunity for improvement?Share a Content Correction

UBR1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Description

Specifications

Product Suggestions

Documents

Promotions