UBR2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP154982

Catalog No. NBP154982

Description

UBR2 Polyclonal specifically detects UBR2 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: UBR2
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: bA49A4.1, C6orf133MGC71112, chromosome 6 open reading frame 133, dJ242G1.1, dJ392M17.3, DKFZp686C08114, E3 ubiquitin-protein ligase UBR2, EC 6.3.2.-, KIAA0349FLJ36357, N-recognin-2, RP3-392M17.3, ubiquitin protein ligase E3 component n-recognin 2, Ubiquitin-protein ligase E3-alpha-2, Ubiquitin-protein ligase E3-alpha-II
• Host Species: Rabbit
• Molecular Weight of Antigen: 200 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q8IWV8
• Gene Symbols: UBR2
• Immunogen: Synthetic peptides corresponding to UBR2(ubiquitin protein ligase E3 component n-recognin 2) The peptide sequence was selected from the C terminal of UBR2. Peptide sequence QGLRRGNPLHLCKERFKKIQKLWHQHSVTEEIGHAQEANQTLVGIDWQHL.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 23304
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG