UBXN1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP156353

Catalog No. NBP156353

Description

UBXN1 Polyclonal specifically detects UBXN1 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: UBXN1
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: 2B28, LOC51035, SAKS1UBA/UBX 33.3 kDa protein, SAPK substrate protein 1, UBX domain protein 1, UBX domain-containing protein 1, UBXD10
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 51035
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q04323-2
• Gene Symbols: UBXN1
• Immunogen: Synthetic peptides corresponding to LOC51035(SAPK substrate protein 1) The peptide sequence was selected from the middle region of LOC51035. Peptide sequence RIQVRLPDGTSLTQTFRAREQLAAVRLYVELHRGEELGGGQDPVQLLSGF.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Bovine: 100%; Canine: 100%; Goat: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Guinea pig: 92%.
• Target Species: Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Goat, Rabbit
• Isotype: IgG