UBXN2A Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP174162

Catalog No. NBP174162

Description

UBXN2A Polyclonal specifically detects UBXN2A in Rat samples. It is validated for Western Blot.

Specifications

• Antigen: UBXN2A
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: MGC138202, UBX domain containing 4, UBX domain protein 2A, UBX domain-containing protein 2A, UBX domain-containing protein 4, UBXD4
• Host Species: Rabbit
• Molecular Weight of Antigen: 29 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Chicken: 78%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: D3ZID8
• Gene Symbols: UBXN2A
• Immunogen: Synthetic peptides corresponding to the middle region of Ubxn2a. Immunizing peptide sequence VCMSTKPVFQPFSGQGHRLGSATPRIVSKAKSIEVDNKSTLSAVSLNNLE.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 165324
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.