Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

UBXN2A Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$206.00 - $487.50

Specifications

Antigen	UBXN2A
Dilution	Western Blot 1.0 ug/ml
Applications	Western Blot
Classification	Polyclonal
Conjugate	Unconjugated

View More Specs

Products 2

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NBP17416220 View Documents View Product Certificates	Novus Biologicals NBP17416220UL	20 μL	Each for $206.00	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

NBP174162 View Documents View Product Certificates	Novus Biologicals NBP174162	100 μL	Each for $487.50	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

UBXN2A Polyclonal specifically detects UBXN2A in Rat samples. It is validated for Western Blot.

Specifications

Antigen	UBXN2A
Applications	Western Blot
Conjugate	Unconjugated
Regulatory Status	RUO
Gene Alias	MGC138202, UBX domain containing 4, UBX domain protein 2A, UBX domain-containing protein 2A, UBX domain-containing protein 4, UBXD4
Gene Symbols	UBXN2A
Isotype	IgG
Molecular Weight of Antigen	29 kDa

Dilution	Western Blot 1.0 ug/ml
Classification	Polyclonal
Host Species	Rabbit
Gene Accession No.	D3ZID8
Gene ID (Entrez)	165324
Immunogen	Synthetic peptides corresponding to the middle region of Ubxn2a. Immunizing peptide sequence VCMSTKPVFQPFSGQGHRLGSATPRIVSKAKSIEVDNKSTLSAVSLNNLE.
Primary or Secondary	Primary

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

UBXN2A Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents