Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
UBXN2A Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP17416220UL
Description
UBXN2A Polyclonal specifically detects UBXN2A in Rat samples. It is validated for Western Blot.Specifications
UBXN2A | |
Polyclonal | |
Western Blot 1.0 ug/ml | |
D3ZID8 | |
UBXN2A | |
Synthetic peptides corresponding to the middle region of Ubxn2a. Immunizing peptide sequence VCMSTKPVFQPFSGQGHRLGSATPRIVSKAKSIEVDNKSTLSAVSLNNLE. | |
Affinity Purified | |
RUO | |
165324 | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
MGC138202, UBX domain containing 4, UBX domain protein 2A, UBX domain-containing protein 2A, UBX domain-containing protein 4, UBXD4 | |
Rabbit | |
29 kDa | |
20 μL | |
Primary | |
Rat | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction