Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

UCH-L3 Antibody, Novus Biologicals™
SDP

Catalog No. NBP155316 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP155316 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP155316 Supplier Novus Biologicals Supplier No. NBP155316
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

UCH-L3 Polyclonal specifically detects UCH-L3 in Human, Zebrafish samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen UCH-L3
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Concentration 0.5 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 4-8 ug/ml
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. P15374
Gene Alias EC 3.4.19.12, ubiquitin carboxyl-terminal esterase L3 (ubiquitin thiolesterase), ubiquitin carboxyl-terminal hydrolase isozyme L3, Ubiquitin thioesterase L3, ubiquitin thiolesterase, UCH-L3
Gene Symbols UCHL3
Host Species Rabbit
Immunogen Synthetic peptides corresponding to UCHL3(ubiquitin carboxyl-terminal esterase L3 (ubiquitin thiolesterase)) The peptide sequence was selected from the N terminal of UCHL3. Peptide sequence MEGQRWLPLEANPEVTNQFLKQLGLHPNWQFVDVYGMDPELLSMVPRPVC The peptide sequence for this immunogen was taken from within the described region.
Molecular Weight of Antigen 25 kDa
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 7347
Test Specificity Goat: 82%.
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Human, Mouse, Rat, Bovine, Equine, Guinea Pig, Goat, Rabbit, Zebrafish
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.