Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
UFL1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP15543820UL
Description
UFL1 Polyclonal specifically detects UFL1 in Human samples. It is validated for Western Blot.Specifications
UFL1 | |
Polyclonal | |
Western Blot 0.2-1 ug/ml | |
O94874 | |
UFL1 | |
Synthetic peptide directed towards the middle region of human UFL1 Peptide sequence: EYLIKPLNKTYLEVVRSVFMSSTTSASGTGRKRTIKDLQEEVSNLYNNIR. | |
Affinity Purified | |
RUO | |
23376 | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
E3 UFM1-protein ligase 1, EC 6.3.2.-, KIAA0776, LZAP-binding protein, NLBPnovel LZAP-binding protein, RP3-393D12.1, UFL1 | |
Rabbit | |
89 kDa | |
20 μL | |
Primary | |
Human | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction