Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. UFL1 Antibody, Novus Biologicals™

UFL1 Antibody, Novus Biologicals™
SDP

Catalog No. NBP15543820 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP15543820 20 μL
NBP155438 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP15543820 Supplier Novus Biologicals Supplier No. NBP15543820UL

Description

Rabbit Polyclonal Antibody

UFL1 Polyclonal specifically detects UFL1 in Human samples. It is validated for Western Blot.

Specifications

Antigen UFL1
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.2-1 ug/ml
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. O94874
Gene Alias E3 UFM1-protein ligase 1, EC 6.3.2.-, KIAA0776, LZAP-binding protein, NLBPnovel LZAP-binding protein, RP3-393D12.1, UFL1
Gene Symbols UFL1
Host Species Rabbit
Immunogen Synthetic peptide directed towards the middle region of human UFL1 Peptide sequence: EYLIKPLNKTYLEVVRSVFMSSTTSASGTGRKRTIKDLQEEVSNLYNNIR.
Molecular Weight of Antigen 89 kDa
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 23376
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.