UIP1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP155442

Catalog No. NBP155442

Description

UIP1 Polyclonal specifically detects UIP1 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: UIP1
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Symbols: HAUS7
• Immunogen: Synthetic peptides corresponding to UCHL5IP(UCHL5 interacting protein) The peptide sequence was selected from the middle region of UCHL5IP. Peptide sequence LLDTIRSLTIGCSSCSSLMEHFEDTREKNEALLGELFSSPHLQMLLNPEC.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 55559
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Alias: 26S proteasome-associated UCH37-interacting protein 1, expressed-Xq28STS protein, HAUS augmin-like complex subunit 7, HAUS augmin-like complex, subunit 7, UCH37 interacting protein 1, UCHL5 interacting protein, UCHL5-interacting protein, UCHL5IPHSXQ28ORF, UIP126S proteasome-associated UCH interacting protein 1, X-linked protein STS1769
• Host Species: Rabbit
• Molecular Weight of Antigen: 47 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: This product is specific to Subunit or Isoform: 7.
• Target Species: Human, Mouse, Pig, Bovine, Canine, Equine, Rabbit
• Isotype: IgG