Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

UIP1 Antibody, Novus Biologicals™
SDP

Rabbit Polyclonal Antibody

$487.50

Specifications

Antigen UIP1
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 1
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP155442
SDP
View Documents
Novus Biologicals
NBP155442
100 μL
Each of 1 for $487.50
Only null left
Add to Cart
 
Description

Description

UIP1 Polyclonal specifically detects UIP1 in Human samples. It is validated for Western Blot.
Specifications

Specifications

UIP1
Polyclonal
Rabbit
26S proteasome-associated UCH37-interacting protein 1, expressed-Xq28STS protein, HAUS augmin-like complex subunit 7, HAUS augmin-like complex, subunit 7, UCH37 interacting protein 1, UCHL5 interacting protein, UCHL5-interacting protein, UCHL5IPHSXQ28ORF, UIP126S proteasome-associated UCH interacting protein 1, X-linked protein STS1769
HAUS7
IgG
This product is specific to Subunit or Isoform: 7.
Western Blot
Unconjugated
RUO
55559
Synthetic peptides corresponding to UCHL5IP(UCHL5 interacting protein) The peptide sequence was selected from the middle region of UCHL5IP. Peptide sequence LLDTIRSLTIGCSSCSSLMEHFEDTREKNEALLGELFSSPHLQMLLNPEC.
Primary
47 kDa
Videos
SDS
Documents

Documents

Product Certifications
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Your feedback has been submitted: Thank you for helping us improve our website.