UNC13B Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP24936425UL

Catalog No. NB395721

Description

UNC13B Polyclonal antibody specifically detects UNC13B in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)

Specifications

• Antigen: UNC13B
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL, Immunohistochemistry-Paraffin 1:500 - 1:1000
• Gene Alias: hmunc13, homolog of rat Munc13 (diacylglycerol-binding), MGC133279, MGC133280, MUNC13, Munc13-2, protein unc-13 homolog B, unc-13 homolog B (C. elegans), unc-13-like (C. elegans), UNC13Unc13h2
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: PPDLVLQKDHFLGPQESFPEENASSPFTQARAHWIRAVTKVRLQLQEIPDD
• Quantity: 25 μL
• Research Discipline: Apoptosis
• Gene ID (Entrez): 10497
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2), 40% Glycerol
• Host Species: Rabbit
• Purification Method: Immunogen affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified