UNC5H1/Unc5a Antibody, Novus Biologicals™

Catalog No.	Quantity
NBP160033	100 μL

Catalog No. NBP160033 Supplier Novus Biologicals Supplier No. NBP160033

Description

Rabbit Polyclonal Antibody

UNC5H1/Unc5a Polyclonal specifically detects UNC5H1/Unc5a in Human samples. It is validated for Western Blot.

Specifications

• Antigen: UNC5H1/Unc5a
• Applications: Western Blot
• Classification: Polyclonal
• Concentration: 0.5 mg/ml
• Conjugate: Unconjugated
• Dilution: Western Blot 1.0 ug/ml
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Accession No.: Q6ZN44
• Gene Alias: KIAA1976netrin receptor UNC5A, netrin receptor Unc5h1, Protein unc-5 homolog 1, Protein unc-5 homolog A, unc5 (C.elegans homolog) a, unc-5 homolog 1, unc-5 homolog A (C. elegans), UNC5H1FLJ16449
• Gene Symbols: UNC5A
• Host Species: Rabbit
• Immunogen: Synthetic peptides corresponding to UNC5A(unc-5 homolog A (C. elegans)) The peptide sequence was selected from the middle region of UNC5A. Peptide sequence VYCRKKEGLDSDVADSSILTSGFQPVSIKPSKADNPHLLTIQPDLSTTTT.
• Purification Method: Affinity purified
• Quantity: 100 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 90249
• Test Specificity: Expected identity based on immunogen sequence: Bovine: 100%; Canine: 100%; Guinea pig: 100%; Equine: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 92%; Chicken: 85%.
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

For Research Use Only