UNC5H3/UNC5C Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP169283

Catalog No. NBP169283

Description

UNC5H3/UNC5C Polyclonal specifically detects UNC5H3/UNC5C in Human samples. It is validated for Western Blot.

Specifications

• Antigen: UNC5H3/UNC5C
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: netrin receptor UNC5C, Protein unc-5 homolog 3, Protein unc-5 homolog C, unc-5 homolog 3, unc-5 homolog C (C. elegans), UNC5H3unc5 (C.elegans homolog) c
• Host Species: Rabbit
• Molecular Weight of Antigen: 103 kDa
• Quantity: 100 μL
• Research Discipline: Apoptosis
• Gene ID (Entrez): 8633
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: O95185
• Gene Symbols: UNC5C
• Immunogen: The immunogen for anti-UNC5C antibody: synthetic peptide directed towards the C terminal of human UNC5C (NP_003719). Peptide sequence WRMLAHKLNLDRYLNYFATKSSPTGVILDLWEAQNFPDGNLSMLAAVLEE.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Reconstitution: Reconstitute with 50μL of distileld water to a final concentration of 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

For Research Use Only