Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. NBP169283

UNC5H3/UNC5C Antibody, Novus Biologicals™
SDP

Catalog No. NBP169283 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP169283 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP169283 Supplier Novus Biologicals Supplier No. NBP169283
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

UNC5H3/UNC5C Polyclonal specifically detects UNC5H3/UNC5C in Human samples. It is validated for Western Blot.

Specifications

Antigen UNC5H3/UNC5C
Applications Western Blot
Classification Polyclonal
Concentration 0.5 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. O95185
Gene Alias netrin receptor UNC5C, Protein unc-5 homolog 3, Protein unc-5 homolog C, unc-5 homolog 3, unc-5 homolog C (C. elegans), UNC5H3unc5 (C.elegans homolog) c
Gene Symbols UNC5C
Host Species Rabbit
Immunogen The immunogen for anti-UNC5C antibody: synthetic peptide directed towards the C terminal of human UNC5C (NP_003719). Peptide sequence WRMLAHKLNLDRYLNYFATKSSPTGVILDLWEAQNFPDGNLSMLAAVLEE.
Molecular Weight of Antigen 103 kDa
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Research Discipline Apoptosis
Primary or Secondary Primary
Gene ID (Entrez) 8633
Reconstitution Reconstitute with 50μL of distileld water to a final concentration of 1mg/mL in PBS buffer.
Target Species Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.