Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. UNC84B Antibody, Novus Biologicals™

UNC84B Antibody, Novus Biologicals™
SDP

Catalog No. NBP15828920 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP15828920 20 μL
NBP158289 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP15828920 Supplier Novus Biologicals Supplier No. NBP15828920UL

Description

Rabbit Polyclonal Antibody

UNC84B Polyclonal specifically detects UNC84B in Human samples. It is validated for Western Blot.

Specifications

Antigen UNC84B
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:100-1:2000
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q9UH99
Gene Alias FRIGG, KIAA0668, MGC133055, MGC133056, nuclear envelope protein, Protein unc-84 homolog B, Rab5-interacting protein, rab5IP, Sad1 and UNC84 domain containing 2, Sad1 unc-84 domain protein 2, Sad1/unc-84 protein-like 2, SUN domain-containing protein 2, unc-84 homolog B, unc-84 homolog B (C. elegans), UNC84B
Gene Symbols SUN2
Host Species Rabbit
Immunogen Synthetic peptides corresponding to UNC84B(unc-84 homolog B (C. elegans)) The peptide sequence was selected from the N terminal of UNC84B. Peptide sequence SRRPDEGWEARDSSPHFQAEQRVMSRVHSLERRLEALAAEFSSNWQKEAM.
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 25777
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.