UNKL Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP233766

Catalog No. NBP233766

Description

UNKL Polyclonal specifically detects UNKL in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: UNKL
• Classification: Polyclonal
• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500
• Gene Accession No.: Q9H9P5
• Gene Symbols: UNKL
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: QEELEGLGVASTLPGLRGCGDIGTIPLPKLHSLQSQLRLDLEAVDGVIFQLRAKQCVACRERAHGAVLRPCQHHILCEPCAATAPECPYC
• Quantity: 0.1 mL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: C16orf28, chromosome 16 open reading frame 28, EC 6.3.2.-, FLJ12623, KIAA0734, Putative E3 ubiquitin-protein ligase UNKL, RING finger protein unkempt-like, unkempt homolog (Drosophila)-like, unkempt-like, ZC3H5LMGC5179, ZC3HDC5LFLJ23360
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 64718
• Target Species: Human
• Isotype: IgG

For Research Use Only