Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. UPF3A Antibody, Novus Biologicals™

UPF3A Antibody, Novus Biologicals™
SDP

Catalog No. NBP15726220 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP15726220 20 μL
NBP157262 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP15726220 Supplier Novus Biologicals Supplier No. NBP15726220UL

Description

Rabbit Polyclonal Antibody

UPF3A Polyclonal specifically detects UPF3A in Human samples. It is validated for Western Blot.

Specifications

Antigen UPF3A
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.2-1 ug/ml
Formulation PBS & 2% Sucrose. with No Preservative
Gene Accession No. Q9H1J1
Gene Alias HUPF3A, Nonsense mRNA reducing factor 3A, regulator of nonsense transcripts 3A, RENT3AUp-frameshift suppressor 3 homolog A, UPF3 regulator of nonsense transcripts homolog A (yeast), UPF3hUpf3
Gene Symbols UPF3A
Host Species Rabbit
Immunogen Synthetic peptides corresponding to UPF3A(UPF3 regulator of nonsense transcripts homolog A (yeast)) The peptide sequence was selected from the middle region of UPF3A (NP_075387). Peptide sequence QRYHVDDGRRHRAHHEPERLSRRSEDEQRWGKGPGQDRGKKGSQDSGAPG.
Molecular Weight of Antigen 55 kDa
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 65110
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.