Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
UPF3A Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP15726220UL
Description
UPF3A Polyclonal specifically detects UPF3A in Human samples. It is validated for Western Blot.Specifications
UPF3A | |
Polyclonal | |
Western Blot 0.2-1 ug/ml | |
Q9H1J1 | |
UPF3A | |
Synthetic peptides corresponding to UPF3A(UPF3 regulator of nonsense transcripts homolog A (yeast)) The peptide sequence was selected from the middle region of UPF3A (NP_075387). Peptide sequence QRYHVDDGRRHRAHHEPERLSRRSEDEQRWGKGPGQDRGKKGSQDSGAPG. | |
Affinity Purified | |
RUO | |
65110 | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS & 2% Sucrose. with No Preservative | |
HUPF3A, Nonsense mRNA reducing factor 3A, regulator of nonsense transcripts 3A, RENT3AUp-frameshift suppressor 3 homolog A, UPF3 regulator of nonsense transcripts homolog A (yeast), UPF3hUpf3 | |
Rabbit | |
55 kDa | |
20 μL | |
Primary | |
Human | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction