Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

UPF3A Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$206.00 - $487.50

Specifications

Antigen	UPF3A
Applications	Western Blot
Classification	Polyclonal
Conjugate	Unconjugated
Host Species	Rabbit

View More Specs

Products 2

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NBP15726220 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP15726220UL	20 μL	Each for $206.00	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

NBP157262 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP157262	100 μL	Each for $487.50	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

UPF3A Polyclonal specifically detects UPF3A in Human samples. It is validated for Western Blot.

Specifications

Antigen	UPF3A
Classification	Polyclonal
Host Species	Rabbit
Target Species	Human
Gene Alias	HUPF3A, Nonsense mRNA reducing factor 3A, regulator of nonsense transcripts 3A, RENT3AUp-frameshift suppressor 3 homolog A, UPF3 regulator of nonsense transcripts homolog A (yeast), UPF3hUpf3
Gene Symbols	UPF3A
Isotype	IgG
Molecular Weight of Antigen	55 kDa

Applications	Western Blot
Conjugate	Unconjugated
Regulatory Status	RUO
Gene Accession No.	Q9H1J1
Gene ID (Entrez)	65110
Immunogen	Synthetic peptides corresponding to UPF3A(UPF3 regulator of nonsense transcripts homolog A (yeast)) The peptide sequence was selected from the middle region of UPF3A (NP_075387). Peptide sequence QRYHVDDGRRHRAHHEPERLSRRSEDEQRWGKGPGQDRGKKGSQDSGAPG.
Primary or Secondary	Primary

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

UPF3A Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents