Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

UPF3B Antibody, Novus Biologicals™
SDP

Catalog No. NBP157233 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
20 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP157233 100 μL
NBP15723320 20 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP157233 Supplier Novus Biologicals Supplier No. NBP157233
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

UPF3B Polyclonal specifically detects UPF3B in Human samples. It is validated for Western Blot.

Specifications

Antigen UPF3B
Applications Western Blot
Classification Polyclonal
Concentration 0.5 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q9BZI7
Gene Alias HUPF3B, Nonsense mRNA reducing factor 3B, regulator of nonsense transcripts 3B, RENT3BhUpf3p-X, UPF3 regulator of nonsense transcripts homolog B (yeast), UPF3XMRXS14, Up-frameshift suppressor 3 homolog B, Up-frameshift suppressor 3 homolog on chromosome X
Gene Symbols UPF3B
Host Species Rabbit
Immunogen Synthetic peptides corresponding to UPF3B(UPF3 regulator of nonsense transcripts homolog B (yeast)) The peptide sequence was selected from the middle region of UPF3B (NP_542199) Peptide sequence KIDRIPERDKLKDEPKIKVHRFLLQAVNQKNLLKKPEKGDEKELDKREKA.
Molecular Weight of Antigen 58 kDa
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 65109
Test Specificity Expected identity based on immunogen sequence: Canine: 100%; Mouse: 92%; Rat: 92%.
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Human, Mouse, Rat, Pig, Canine, Rabbit
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.