UQCR10 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP162349

Catalog No. NBP162349

Description

UQCR10 Polyclonal specifically detects UQCR10 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: UQCR10
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: Complex III subunit 9, Complex III subunit X, cytochrome b-c1 complex subunit 9, Cytochrome c1 non-heme 7 kDa protein, cytochrome C1, nonheme 7kDa protein, HSPC051, HSPC151, QCR9, ubiquinol-cytochrome c reductase complex (7.2 kD), ubiquinol-cytochrome c reductase, complex III subunit X, ubiquinol-cytochrome c reductase, complex III subunit X, 7.2kDa, UCCR7.2, UCRCUbiquinol-cytochrome c reductase complex 7.2 kDa protein
• Host Species: Rabbit
• Molecular Weight of Antigen: 7 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: This product is specific to Subunit or Isoform: 9.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Guinea Pig, Rabbit
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin), Immunofluorescence, Immunohistochemistry (Paraffin)
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin
• Gene Accession No.: Q9UDW1
• Gene Symbols: UQCR10
• Immunogen: Synthetic peptides corresponding to UCRC(ubiquinol-cytochrome c reductase complex (7.2 kD)) The peptide sequence was selected from the middle region of UCRC. Peptide sequence LFRRTSTFALTIIVGVMFFERAFDQGADAIYDHINEGKLWKHIKHKYENK.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 29796
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

For Research Use Only