UQCRFS1 Antibody, Novus Biologicals™

Catalog No.	Quantity
NBP187826	0.1 mL

Catalog No. NBP187826 Supplier Novus Biologicals Supplier No. NBP187826

Description

Rabbit Polyclonal Antibody has been used in 2 publications

UQCRFS1 Polyclonal specifically detects UQCRFS1 in Human, Rat samples. It is validated for Western Blot, Simple Western, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: UQCRFS1
• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Classification: Polyclonal
• Conjugate: Unconjugated
• Dilution: Western Blot 0.04-0.4 μg/mL, Simple Western 1:30, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 0.25-2 μg/mL, Immunohistochemistry-Paraffin 1:50-1:200
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: Complex III subunit 5, Cytochrome b-c1 complex subunit 5, cytochrome b-c1 complex subunit Rieske, mitochondrial, EC 1.10.2.2, Rieske iron-sulfur protein, RIP1, RIS1, RISPUbiquinol-cytochrome c reductase iron-sulfur subunit, ubiquinol-cytochrome c reductase, Rieske iron-sulfur polypeptide 1, UQCR5
• Gene Symbols: UQCRFS1
• Host Species: Rabbit
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:RVKKPEWVILIGVCTHLGCVPIANAGDFGGYYCPCHGSHYDASGRIRLGPAPLNLEVPTYEFTSDDMVIV
• Purification Method: Affinity Purified
• Quantity: 0.1 mL
• Regulatory Status: RUO
• Research Discipline: Breast Cancer
• Primary or Secondary: Primary
• Gene ID (Entrez): 7386
• Test Specificity: Specificity of human UQCRFS1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Target Species: Human, Rat
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

For Research Use Only