UQCRFS1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP238623

Catalog No. NBP238623

Description

UQCRFS1 Polyclonal specifically detects UQCRFS1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin, Knockdown Validated.

Specifications

• Antigen: UQCRFS1
• Classification: Polyclonal
• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Accession No.: P47985
• Gene Symbols: UQCRFS1
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: VTQFVSSMSASADVLALAKIEIKLSDIPEGKNMAFKWRGKPLFVRHRTQKEIEQEAAVELSQLRDPQHDL
• Quantity: 0.1 mL
• Research Discipline: Breast Cancer
• Gene ID (Entrez): 7386
• Target Species: Human
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: Complex III subunit 5, Cytochrome b-c1 complex subunit 5, cytochrome b-c1 complex subunit Rieske, mitochondrial, EC 1.10.2.2, Rieske iron-sulfur protein, RIP1, RIS1, RISPUbiquinol-cytochrome c reductase iron-sulfur subunit, ubiquinol-cytochrome c reductase, Rieske iron-sulfur polypeptide 1, UQCR5
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.