Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Uridine Phosphorylase 1/UPP1 Rabbit anti-Human, Mouse, Rat, Clone: 3E2I2, Novus Biologicals™

Rabbit Monoclonal Antibody
Supplier: Novus Biologicals NBP315285100UL
This item is not returnable.
View return policy
Description
Uridine Phosphorylase 1/UPP1 Monoclonal antibody specifically detects Uridine Phosphorylase 1/UPP1 in Human, Mouse, Rat samples. It is validated for Western BlotSpecifications
Uridine Phosphorylase 1/UPP1 | |
Monoclonal | |
Unconjugated | |
PBS, 0.05% BSA, 50% glycerol, pH7.3 | |
Rabbit | |
Affinity purified | |
RUO | |
Primary | |
Human, Mouse, Rat | |
Purified |
Western Blot | |
3E2I2 | |
Western Blot 1:500 - 1:1000 | |
EC 2.4.2.3, UDRPASE, UPASE, UPP, UPUPase 1, UrdPase 1, uridine phosphorylase, uridine phosphorylase 1 | |
A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Uridine Phosphorylase 1/UPP1 (Q16831). MAATGANAEKAESHNDCPVRLLNPNIAKMKEDILYHFNLTTSRHNFPALFGDVKFVCVGGSPSRMKAFIRCVGAELGLDCPGRDYPNICAGTDRYAMYKV | |
100 μg | |
Cancer, Endocrinology, Signal Transduction | |
7378 | |
Store at -20°C. Avoid freeze-thaw cycles. | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction