Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Uridine Phosphorylase 1/UPP1 Rabbit anti-Human, Mouse, Rat, Clone: 3E2I2, Novus Biologicals™

Rabbit Monoclonal Antibody
$205.50 - $492.50
Specifications
Antigen | Uridine Phosphorylase 1/UPP1 |
---|---|
Clone | 3E2I2 |
Dilution | Western Blot 1:500 - 1:1000 |
Applications | Western Blot |
Classification | Monoclonal |
Description
Uridine Phosphorylase 1/UPP1 Monoclonal antibody specifically detects Uridine Phosphorylase 1/UPP1 in Human, Mouse, Rat samples. It is validated for Western BlotSpecifications
Uridine Phosphorylase 1/UPP1 | |
Western Blot 1:500 - 1:1000 | |
Monoclonal | |
Purified | |
RUO | |
Human, Mouse, Rat | |
EC 2.4.2.3, UDRPASE, UPASE, UPP, UPUPase 1, UrdPase 1, uridine phosphorylase, uridine phosphorylase 1 | |
A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Uridine Phosphorylase 1/UPP1 (Q16831). MAATGANAEKAESHNDCPVRLLNPNIAKMKEDILYHFNLTTSRHNFPALFGDVKFVCVGGSPSRMKAFIRCVGAELGLDCPGRDYPNICAGTDRYAMYKV | |
Primary | |
Store at -20°C. Avoid freeze-thaw cycles. |
3E2I2 | |
Western Blot | |
Unconjugated | |
Rabbit | |
Cancer, Endocrinology, Signal Transduction | |
PBS, 0.05% BSA, 50% glycerol, pH7.3 | |
7378 | |
IgG | |
Affinity purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title