Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Uridine Phosphorylase 1/UPP1 Rabbit anti-Human, Mouse, Rat, Clone: 3E2I2, Novus Biologicals™

Rabbit Monoclonal Antibody

$205.50 - $492.50

Specifications

Antigen	Uridine Phosphorylase 1/UPP1
Clone	3E2I2
Dilution	Western Blot 1:500 - 1:1000
Applications	Western Blot
Classification	Monoclonal

View More Specs

Products 2

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NB165667 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP31528520UL	20 μg	Each for $205.50	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

NB165666 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP315285100UL	100 μg	Each for $492.50	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

Uridine Phosphorylase 1/UPP1 Monoclonal antibody specifically detects Uridine Phosphorylase 1/UPP1 in Human, Mouse, Rat samples. It is validated for Western Blot

Specifications

Antigen	Uridine Phosphorylase 1/UPP1
Dilution	Western Blot 1:500 - 1:1000
Classification	Monoclonal
Form	Purified
Regulatory Status	RUO
Target Species	Human, Mouse, Rat
Gene Alias	EC 2.4.2.3, UDRPASE, UPASE, UPP, UPUPase 1, UrdPase 1, uridine phosphorylase, uridine phosphorylase 1
Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Uridine Phosphorylase 1/UPP1 (Q16831). MAATGANAEKAESHNDCPVRLLNPNIAKMKEDILYHFNLTTSRHNFPALFGDVKFVCVGGSPSRMKAFIRCVGAELGLDCPGRDYPNICAGTDRYAMYKV
Primary or Secondary	Primary
Content And Storage	Store at -20°C. Avoid freeze-thaw cycles.

Clone	3E2I2
Applications	Western Blot
Conjugate	Unconjugated
Host Species	Rabbit
Research Discipline	Cancer, Endocrinology, Signal Transduction
Formulation	PBS, 0.05% BSA, 50% glycerol, pH7.3
Gene ID (Entrez)	7378
Isotype	IgG
Purification Method	Affinity purified

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

Uridine Phosphorylase 1/UPP1 Rabbit anti-Human, Mouse, Rat, Clone: 3E2I2, Novus Biologicals™

Specifications

Description

Specifications

Documents