Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. Use1/UBE2Z Antibody, Novus Biologicals™

Use1/UBE2Z Antibody, Novus Biologicals™
SDP

Catalog No. NBP238568 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
0.1 mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP238568 0.1 mL
NB436175 25 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP238568 Supplier Novus Biologicals Supplier No. NBP238568
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

Use1/UBE2Z Polyclonal specifically detects Use1/UBE2Z in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen Use1/UBE2Z
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Accession No. Q9NZ43
Gene Alias MDS032, P31, protein p31, putative MAPK activating protein PM26, Putative MAPK-activating protein PM26, Q-SNARE, SLT1, SNARE-like tail-anchored protein 1 homolog, unconventional SNARE in the ER 1 homolog (S. cerevisiae), USE1L, USE1-like protein, vesicle transport protein USE1
Gene Symbols USE1
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: SRLELNLVRLLSRCEAMAAEKRDPDEWRLEKYVGALEDMLQALKVHASKPASEVINEYSWKVDFLKGMLQAEKLTSSSEKALANQFLAPGRVPTTARERVPATKTVHL
Purification Method Affinity Purified
Quantity 0.1 mL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 55850
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.