Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. NBP155441

USP12 Antibody, Novus Biologicals™
SDP

Catalog No. NBP155441 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP155441 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP155441 Supplier Novus Biologicals Supplier No. NBP155441
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

USP12 Polyclonal specifically detects USP12 in Human samples. It is validated for Western Blot.

Specifications

Antigen USP12
Applications Western Blot
Classification Polyclonal
Concentration 0.5 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. O75317
Gene Alias Deubiquitinating enzyme 12, EC 3.1.2.15, EC 3.4.19.12, UBH1ubiquitin specific protease 12, ubiquitin carboxyl-terminal hydrolase 12, ubiquitin specific peptidase 12, ubiquitin specific protease 12 like 1, ubiquitin thioesterase 12, Ubiquitin thiolesterase 12, Ubiquitin-hydrolyzing enzyme 1, Ubiquitin-specific-processing protease 12, USP12L1
Gene Symbols USP12
Host Species Rabbit
Immunogen Synthetic peptides corresponding to USP12(ubiquitin specific peptidase 12) The peptide sequence was selected from the middle region of USP12. Peptide sequence ITRLRKENELFDNYMQQDAHEFLNYLLNTIADILQEERKQEKQNGRLPNG.
Molecular Weight of Antigen 43 kDa
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 219333
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.