Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. NB301232

USP26 Antibody, Novus Biologicals™
SDP

Catalog No. NB301232 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB301232 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NB301232 Supplier Novus Biologicals Supplier No. NBP325220
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

USP26 Polyclonal antibody specifically detects USP26 in Human samples. It is validated for Immunocytochemistry/ Immunofluorescence

Specifications

Antigen USP26
Applications Immunocytochemistry
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL
Formulation PBS, pH 7.2, 40% glycerol
Gene Alias Deubiquitinating enzyme 26, EC 3.4.19.12, MGC120066, MGC120067, MGC120068, ubiquitin carboxyl-terminal hydrolase 26, ubiquitin specific peptidase 26, ubiquitin specific protease 26, ubiquitin thioesterase 26, Ubiquitin thiolesterase 26, ubiquitin-specific processing protease 26, Ubiquitin-specific-processing protease 26
Host Species Rabbit
Immunogen This antibody has been engineered to specifically recognize the recombinant protein USP26 using the following amino acid sequence: VPENPKRKKYVKTSKFVAFDRIINPTKDLYEDKNIRIPERFQKVSEQTQQCDGMRICEQAPQQALPQSFPKPGTQGHTKNLLRP
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Research Discipline Cell Biology
Primary or Secondary Primary
Gene ID (Entrez) 83844
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.