Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. USP29 Antibody, Novus Biologicals™

USP29 Antibody, Novus Biologicals™
SDP

Catalog No. NBP17974820 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP17974820 20 μL
NBP179748 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP17974820 Supplier Novus Biologicals Supplier No. NBP17974820UL

Description

Rabbit Polyclonal Antibody

USP29 Polyclonal specifically detects USP29 in Human samples. It is validated for Western Blot.

Specifications

Antigen USP29
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:1000
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. NP_065954
Gene Alias Deubiquitinating enzyme 29, EC 3.1.2.15, EC 3.4.19.12, HOM-TES-84/86, MGC163266, MGC163270, ubiquitin carboxyl-terminal hydrolase 29, ubiquitin specific peptidase 29, ubiquitin specific protease 29, ubiquitin thioesterase 29, Ubiquitin thiolesterase 29, ubiquitin-specific processing protease, Ubiquitin-specific-processing protease 29
Gene Symbols USP29
Host Species Rabbit
Immunogen Synthetic peptide directed towards the N terminal of human USP29The immunogen for this antibody is USP29. Peptide sequence EDILKEDNPVPNKKYKTDSLKYIQSNRKNPSSLEDLEKDRDLKLGPSFNT.
Molecular Weight of Antigen 104 kDa
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 57663
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.