USP29 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP17974820UL

Catalog No. NBP17974820

Description

USP29 Polyclonal specifically detects USP29 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: USP29
• Classification: Polyclonal
• Dilution: Western Blot 1:1000
• Gene Accession No.: NP_065954
• Gene Symbols: USP29
• Immunogen: Synthetic peptide directed towards the N terminal of human USP29The immunogen for this antibody is USP29. Peptide sequence EDILKEDNPVPNKKYKTDSLKYIQSNRKNPSSLEDLEKDRDLKLGPSFNT.
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 57663
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: Deubiquitinating enzyme 29, EC 3.1.2.15, EC 3.4.19.12, HOM-TES-84/86, MGC163266, MGC163270, ubiquitin carboxyl-terminal hydrolase 29, ubiquitin specific peptidase 29, ubiquitin specific protease 29, ubiquitin thioesterase 29, Ubiquitin thiolesterase 29, ubiquitin-specific processing protease, Ubiquitin-specific-processing protease 29
• Host Species: Rabbit
• Molecular Weight of Antigen: 104 kDa
• Quantity: 20 μL
• Primary or Secondary: Primary
• Target Species: Human
• Isotype: IgG