Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
USP29 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$206.00 - $487.50
Specifications
Antigen | USP29 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP17974820
![]() |
Novus Biologicals
NBP17974820UL |
20 μL |
Each for $206.00
|
|
|||||
NBP179748
![]() |
Novus Biologicals
NBP179748 |
100 μL |
Each for $487.50
|
|
|||||
Description
USP29 Polyclonal specifically detects USP29 in Human samples. It is validated for Western Blot.Specifications
USP29 | |
Polyclonal | |
Rabbit | |
Human | |
Deubiquitinating enzyme 29, EC 3.1.2.15, EC 3.4.19.12, HOM-TES-84/86, MGC163266, MGC163270, ubiquitin carboxyl-terminal hydrolase 29, ubiquitin specific peptidase 29, ubiquitin specific protease 29, ubiquitin thioesterase 29, Ubiquitin thiolesterase 29, ubiquitin-specific processing protease, Ubiquitin-specific-processing protease 29 | |
USP29 | |
IgG | |
104 kDa |
Western Blot | |
Unconjugated | |
RUO | |
NP_065954 | |
57663 | |
Synthetic peptide directed towards the N terminal of human USP29The immunogen for this antibody is USP29. Peptide sequence EDILKEDNPVPNKKYKTDSLKYIQSNRKNPSSLEDLEKDRDLKLGPSFNT. | |
Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title