Learn More
Description
Specifications
Specifications
| Antigen | USP35 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Formulation | PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide |
| Gene Alias | Deubiquitinating enzyme 35, EC 3.4.19.12, KIAA1372, ubiquitin carboxyl-terminal hydrolase 35, ubiquitin specific peptidase 35, ubiquitin specific protease 35, ubiquitin thioesterase 35, Ubiquitin thiolesterase 35, Ubiquitin-specific-processing protease 35, USP34 |
| Gene Symbols | USP35 |
| Host Species | Rabbit |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: LYLQEQEKEARSRAAYISALPTSPHWGRGFDEDKDEDEGSPGGCNPAGGNGGDFHRLVF |
| Show More |
For Research Use Only
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
