Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

USP46 Antibody (CL0364), Novus Biologicals™
SDP

Catalog No. NBP230417 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
0.1 mL
25ul
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP230417 0.1 mL
NB437615 25ul
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP230417 Supplier Novus Biologicals Supplier No. NBP230417
Add to Cart
Add to Cart

Mouse Monoclonal Antibody

USP46 Monoclonal specifically detects USP46 in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.

Specifications

Antigen USP46
Applications Western Blot, Immunocytochemistry, Immunofluorescence
Classification Monoclonal
Clone CL0364
Conjugate Unconjugated
Dilution Western Blot 1 μg/mL, Immunocytochemistry/Immunofluorescence 2-10 μg/mL
Gene Accession No. P62068
Gene Alias Deubiquitinating enzyme 46, EC 3.1.2.15, EC 3.4.19.12, FLJ11850, FLJ12552, FLJ14283, FLJ39393, ubiquitin carboxyl-terminal hydrolase 46, ubiquitin specific peptidase 46, ubiquitin specific protease 46, ubiquitin thioesterase 46, Ubiquitin thiolesterase 46, Ubiquitin-specific-processing protease 46
Gene Symbols USP46
Host Species Mouse
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: LFDNYMQQDAHEFLNYLLNTIADILQEEKKQEKQNGKLKNGNMNEPAENNKPELTWVHEIFQGTLTNETRCLNCETVSSKDEDFLDLSVDVEQN
Purification Method Protein A purified
Quantity 0.1 mL
Regulatory Status RUO
Research Discipline DNA replication Transcription Translation and Splicing
Primary or Secondary Primary
Gene ID (Entrez) 64854
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG2a
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.