USP49 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Catalog Number	Mfr. No.	Quantity
NB419129	Novus Biologicals NBP18117425UL	25ul
NBP181174	Novus Biologicals NBP181174	0.1 mL

Description

USP49 Polyclonal specifically detects USP49 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: USP49
• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: Deubiquitinating enzyme 49, EC 3.1.2.15, EC 3.4.19.12, MGC20741, ubiquitin carboxyl-terminal hydrolase 49, ubiquitin specific peptidase 49, ubiquitin specific protease 49, ubiquitin thioesterase 49, Ubiquitin thiolesterase 49, Ubiquitin-specific-processing protease 49
• Gene Symbols: USP49
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
• Classification: Polyclonal
• Host Species: Rabbit
• Target Species: Human
• Gene Accession No.: Q70CQ1
• Gene ID (Entrez): 25862
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:ECFLNLDPSKTEHLFPKATNGKTQLSGKPTNSSATELSLRNDRAEACEREGFCWNGRASISRSLELIQNKEPSSK
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Molecular Weight of Antigen: 79 kDa

For Research Use Only