Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
USP49 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP181174
Description
USP49 Polyclonal specifically detects USP49 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
USP49 | |
Polyclonal | |
Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
Q70CQ1 | |
USP49 | |
This antibody was developed against Recombinant Protein corresponding to amino acids:ECFLNLDPSKTEHLFPKATNGKTQLSGKPTNSSATELSLRNDRAEACEREGFCWNGRASISRSLELIQNKEPSSK | |
Affinity Purified | |
RUO | |
25862 | |
Human | |
IgG |
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
Deubiquitinating enzyme 49, EC 3.1.2.15, EC 3.4.19.12, MGC20741, ubiquitin carboxyl-terminal hydrolase 49, ubiquitin specific peptidase 49, ubiquitin specific protease 49, ubiquitin thioesterase 49, Ubiquitin thiolesterase 49, Ubiquitin-specific-processing protease 49 | |
Rabbit | |
79 kDa | |
0.1 mL | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction