USP9Y Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP179749

Catalog No. NBP179749

Description

USP9Y Polyclonal specifically detects USP9Y in Human samples. It is validated for Western Blot.

Specifications

• Antigen: USP9Y
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: Deubiquitinating enzyme FAF-Y, DFFRYFLJ33043, EC 3.1.2.15, EC 3.4.19.12, Fat facets protein-related, Y-linked, probable ubiquitin carboxyl-terminal hydrolase FAF-Y, ubiquitin specific peptidase 9, Y-linked, ubiquitin specific peptidase 9, Y-linked (fat facets-like, Drosophila), ubiquitin thioesterase FAF-Y, Ubiquitin thiolesterase FAF-Y, ubiquitin-specific processing protease FAF-Y, Ubiquitin-specific protease 9, Y chromosome, Ubiquitin-specific-processing protease FAF-Y
• Host Species: Rabbit
• Molecular Weight of Antigen: 291 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Dog: 86%; Pig: 86%; Rat: 86%; Horse: 86%; Mouse: 86%; Bovine: 86%; Rabbit: 86%.
• Target Species: Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Rabbit
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: NP_004645
• Gene Symbols: USP9Y
• Immunogen: Synthetic peptide directed towards the C terminal of human USP9YThe immunogen for this antibody is USP9Y. Peptide sequence PHSPASQYQQNNHVHGQPYTGPAAHHLNNPQKTGQRTQENYEGNEEVSSP.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 8287
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.