Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
USP9Y Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$206.00 - $487.50
Specifications
| Antigen | USP9Y |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP17974920
|
Novus Biologicals
NBP17974920UL |
20 μL |
Each for $206.00
|
|
|||||
|
NBP179749
|
Novus Biologicals
NBP179749 |
100 μL |
Each for $487.50
|
|
|||||
Description
USP9Y Polyclonal specifically detects USP9Y in Human samples. It is validated for Western Blot.Specifications
| USP9Y | |
| Polyclonal | |
| Rabbit | |
| NP_004645 | |
| 8287 | |
| Synthetic peptide directed towards the C terminal of human USP9YThe immunogen for this antibody is USP9Y. Peptide sequence PHSPASQYQQNNHVHGQPYTGPAAHHLNNPQKTGQRTQENYEGNEEVSSP. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Deubiquitinating enzyme FAF-Y, DFFRYFLJ33043, EC 3.1.2.15, EC 3.4.19.12, Fat facets protein-related, Y-linked, probable ubiquitin carboxyl-terminal hydrolase FAF-Y, ubiquitin specific peptidase 9, Y-linked, ubiquitin specific peptidase 9, Y-linked (fat facets-like, Drosophila), ubiquitin thioesterase FAF-Y, Ubiquitin thiolesterase FAF-Y, ubiquitin-specific processing protease FAF-Y, Ubiquitin-specific protease 9, Y chromosome, Ubiquitin-specific-processing protease FAF-Y | |
| USP9Y | |
| IgG | |
| 291 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title