Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

UST Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$487.50

Specifications

Antigen	UST
Applications	Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification	Polyclonal
Conjugate	Unconjugated
Form	Purified

View More Specs

Products 1

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NBP160042 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP160042	100 μL	Each of 1 for $487.50	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

UST Polyclonal specifically detects UST in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen	UST
Classification	Polyclonal
Form	Purified
Regulatory Status	RUO
Gene Alias	2OST, dermatan/chondroitin sulfate 2-sulfotransferase, DS2ST, EC 2.8.2.-, uronyl 2-sulfotransferase, uronyl-2-sulfotransferase
Gene Symbols	UST
Isotype	IgG
Purification Method	Protein A purified

Applications	Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate	Unconjugated
Host Species	Rabbit
Gene Accession No.	Q9Y2C2
Gene ID (Entrez)	10090
Immunogen	Synthetic peptide directed towards the C terminal of human UST (NP_005706). Peptide sequence YFKGVLSIYKDPEHRKLGNMTVTVKKTVPSPEAVQILYQRMRYEYEFYHY.
Primary or Secondary	Primary
Molecular Weight of Antigen	48 kDa

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

UST Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents