UTP14C Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP23348325UL

Catalog No. NB436870

Description

UTP14C Polyclonal specifically detects UTP14C in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: UTP14C
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:500 - 1:1000
• Gene Accession No.: Q5TAP6
• Gene Symbols: UTP14C
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: ARMMERMSLKHQNSGKWAKSKAIMAKYDLEARQAMQEQLAKNKELTQKLQVASESEEE
• Quantity: 25 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: 2700066J21Rik, KIAA0266, U3 Small Nucleolar RNA-Associated Protein 14 Homolog C, UTP14, U3 Small Nucleolar Ribonucleoprotein, Homolog C (Yeast), UTP14B
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 9724
• Target Species: Human
• Isotype: IgG

For Research Use Only