Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
OTOS Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP19841720UL
Description
OTOS Polyclonal specifically detects OTOS in Mouse samples. It is validated for Western Blot.Specifications
OTOS | |
Polyclonal | |
Western Blot 1:1000 | |
NP_694754 | |
OTOS | |
The immunogen for this antibody is Otos - middle region. Peptide sequence YWPFSTSDFWNYVQYFQTQGAYPQIEDMARTFFAHFPLGSTLGFHVPYQE. | |
Affinity Purified | |
RUO | |
150677 | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
OTOSP, otospiralin | |
Rabbit | |
10 kDa | |
20 μL | |
Primary | |
Mouse | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction