Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. DUSP7 Antibody, Novus Biologicals™

DUSP7 Antibody, Novus Biologicals™
SDP

Catalog No. NBP19842420 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP19842420 20 μL
NBP198424 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP19842420 Supplier Novus Biologicals Supplier No. NBP19842420UL

Description

Rabbit Polyclonal Antibody

DUSP7 Polyclonal specifically detects DUSP7 in Rat samples. It is validated for Western Blot.

Specifications

Antigen DUSP7
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:1000
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. XP_238551
Gene Alias DKFZp586F2224, dual specificity phosphatase 7, Dual specificity protein phosphatase PYST2, dual-specificity phosphatase-7, EC 3.1.3.16, EC 3.1.3.48, MKPX, MKP-X, PYST2dual specificity protein phosphatase 7
Gene Symbols DUSP7
Host Species Rabbit
Immunogen The immunogen for this antibody is Dusp7 - middle region. Peptide sequence GLGGLRISSDCSDGESDRELPSSATESDGSPVPSSQPAFPVQILPYLYLG.
Molecular Weight of Antigen 46 kDa
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 1849
Target Species Rat
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.