PNCK Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP198426

Catalog No. NBP198426

Description

PNCK Polyclonal specifically detects PNCK in Rat samples. It is validated for Western Blot.

Specifications

• Antigen: PNCK
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: BSTK3, calcium/calmodulin-dependent protein kinase type 1B, CaM kinase I beta, CaM kinase IB, CaMK1b, CaM-KI beta, CaMKI-beta, EC 2.7.11, EC 2.7.11.17, FLJ50403, FLJ50549, FLJ56451, FLJ59811, MGC45419, pregnancy up-regulated non-ubiquitously expressed CaM kinase, pregnancy upregulated non-ubiquitously expressed CaM kinase, Pregnancy up-regulated non-ubiquitously-expressed CaM kinase
• Host Species: Rabbit
• Molecular Weight of Antigen: 37 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: NP_058971
• Gene Symbols: PNCK
• Immunogen: The immunogen for this antibody is Pnck - C-terminal region. Peptide sequence QKNFARTHWKRAFNATSFLRHIRKLGQSPEGEEASRQGMTRHSHPGLGTS.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 139728
• Target Species: Human, Mouse, Rat, Pig, Bovine, Canine, Rabbit
• Isotype: IgG