Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SQRDL Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$158.00
Specifications
| Antigen | SQRDL |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP1984320
|
Novus Biologicals
NBP19843120UL |
20 μL |
Each for $158.00
|
|
|||||
|
NBP198431
|
Novus Biologicals
NBP198431 |
100 μL | N/A | N/A | N/A | ||||
Description
SQRDL Polyclonal specifically detects SQRDL in Mouse samples. It is validated for Western Blot.Specifications
| SQRDL | |
| Polyclonal | |
| Rabbit | |
| NP_067482 | |
| 58472 | |
| The immunogen for this antibody is Sqrdl - C-terminal region. Peptide sequence AQSGILDRTMCLIMKNQRPIKKYDGYTSCPLVTGYNRVILAEFDYTAQPL. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| CGI-44, sulfide dehydrogenase like, sulfide quinone reductase-like (yeast), sulfide:quinone oxidoreductase, mitochondrial | |
| SQRDL | |
| IgG | |
| 50 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title